PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Vang06g17820.1
Common NameLR48_Vigan02g107600
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna
Family NF-YB
Protein Properties Length: 152aa    MW: 16946 Da    PI: 5.8278
Description NF-YB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Vang06g17820.1genomeSNUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YB177.61.2e-5540135297
           NF-YB   2 reqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyrelege 96 
                     +eqdr+lPianv+rimk++lP nakisk+aket+qecvsefisfvt+easdkc++ekrkt+ngdd++walatlGf+dy+eplk yl+kyrelege
  Vang06g17820.1  40 KEQDRLLPIANVGRIMKQTLPPNAKISKEAKETMQECVSEFISFVTGEASDKCHKEKRKTVNGDDICWALATLGFDDYAEPLKRYLHKYRELEGE 134
                     89*******************************************************************************************99 PP

           NF-YB  97 k 97 
                     +
  Vang06g17820.1 135 R 135
                     7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.20.102.0E-5336142IPR009072Histone-fold
SuperFamilySSF471132.33E-4042141IPR009072Histone-fold
PfamPF008083.6E-2845109IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
PRINTSPR006151.5E-207391No hitNo description
PROSITE patternPS0068507692IPR003956Transcription factor, NFYB/HAP3, conserved site
PRINTSPR006151.5E-2092110No hitNo description
PRINTSPR006151.5E-20111129No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 152 aa     Download sequence    Send to blast
MGDNINIGKV LDREGFKYNF TCSTSTATAS DTSAQDGVIK EQDRLLPIAN VGRIMKQTLP  60
PNAKISKEAK ETMQECVSEF ISFVTGEASD KCHKEKRKTV NGDDICWALA TLGFDDYAEP  120
LKRYLHKYRE LEGERATQNK SNTYENNIAN I*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4g91_B8e-4639130192Transcription factor HapC (Eurofung)
4g92_B8e-4639130192Transcription factor HapC (Eurofung)
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150410.0AP015041.1 Vigna angularis var. angularis DNA, chromosome 8, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007144547.11e-101hypothetical protein PHAVU_007G165100g
SwissprotO822481e-61NFYB5_ARATH; Nuclear transcription factor Y subunit B-5
TrEMBLA0A0S3SS711e-111A0A0S3SS71_PHAAN; Uncharacterized protein
TrEMBLA0A0L9TWP11e-111A0A0L9TWP1_PHAAN; Uncharacterized protein
STRINGGLYMA02G17310.17e-94(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF80532131
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G47810.17e-62nuclear factor Y, subunit B5
Publications ? help Back to Top
  1. Yang K, et al.
    Genome sequencing of adzuki bean (Vigna angularis) provides insight into high starch and low fat accumulation and domestication.
    Proc. Natl. Acad. Sci. U.S.A., 2015. 112(43): p. 13213-8
    [PMID:26460024]